Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Swine TNF alpha Recombinant Protein

The Swine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Swine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086) . For research use only.

Product Specifications

Background

TNF alpha is a member of the TNF Superfamily. It is produced chiefly by activated macrophages, but it is produced also by a broad variety of cell types including lymphoid cells, mast cells, endothelial cells, cardiac myocytes, adipose tissue, fibroblasts, and neuronal tissue. The primary role of TNF alpha is in the regulation of immune cells. TNF alpha, being an endogenous pyrogen, is able to induce fever, to induce apoptotic cell death, to induce sepsis (through IL-1 & IL-6 production), to induce cachexia, induce inflammation, and to inhibit tumorigenesis and viral replication.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Sus scrofa (pig)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

34.6 kda

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STARD5 Protein Vector (Human) (pPM-C-His)
PV133921 500 ng

STARD5 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PWWP2B CRISPR Knock Out 293T Cell Line (Human)
38232141 1x 10^6 Cells / 1.0 mL

PWWP2B CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
HOXC10 polyclonal antibody
BS60596-01 50 µL

HOXC10 polyclonal antibody

Sign In for Pricing
View Details
HOXC10 polyclonal antibody
BS60596-02 100 µL

HOXC10 polyclonal antibody

Sign In for Pricing
View Details
TBR1 Antibody (N-term)
MBS9214805-01 0.08 mL

TBR1 Antibody (N-term)

Sign In for Pricing
View Details
TBR1 Antibody (N-term)
MBS9214805-02 0.4 mL

TBR1 Antibody (N-term)

Sign In for Pricing
View Details