Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine SCF (Stem Cell Factor) Recombinant Protein

The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248) ) (Gene ID: 403507) . For research use only.

Product Specifications

Background

SCF (stem cell factor), often known as Kit Ligand, KITL or KITLG, is involved in pathways that control the regulation of cell survival, migration and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, and melanogenesis. The SCF of most vertebrates has a soluble form as well as the membrane bound type I receptor form. Mutations in the SCF pathway may result in a broad range of abnormalities including anemia, and sterility. SCF and KIT interaction has been shown to promote the growth of cancer cells and organoids in culture, and xenograft tumors in mice. SCF is being utilized in many animal model systems, from metastasis research in breast tumor-bearing arthritic mice to the genetic linkage to de-pigmentation in pigs. Interestingly, a second SCF pathway was retained in zebrafish, after a whole genome duplication, and is now undergoing divergent evolution.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Canis lupus dingo (dingo), Canis lupus familiaris (dog)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

27.7 kda

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASC3 Rabbit Polyclonal Antibody (APC)
orb1007289 100 µL

CASC3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
KRT17 (Keratin, Type I Cytoskeletal 17, 39.1, Cytokeratin-17, CK-17, Keratin-17, K17) (APC)
128936-APC 100 µL

KRT17 (Keratin, Type I Cytoskeletal 17, 39.1, Cytokeratin-17, CK-17, Keratin-17, K17) (APC)

Sign In for Pricing
View Details
PAX8 (HRP)
571521-01 50 µL

PAX8 (HRP)

Sign In for Pricing
View Details
PAX8 (HRP)
571521-02 100 µL

PAX8 (HRP)

Sign In for Pricing
View Details
2’-Deoxyguanosine hydrate
HIA12155-01 50 g

2’-Deoxyguanosine hydrate

Sign In for Pricing
View Details
2’-Deoxyguanosine hydrate
HIA12155-02 100 g

2’-Deoxyguanosine hydrate

Sign In for Pricing
View Details