Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-16 Recombinant Protein

The Bovine IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130) ) (Gene ID: 506314) . For research use only.

Product Specifications

Background

IL-16 is a pleiotropic cytokine that has been characterized as a chemoattractant for certain immune cells expressing the cell surface molecule CD4, and has effects on mixed lymphocyte reaction and inhibition of HIV viral replication. IL-16 forms homotetramers and this structure is required for its bioactivity. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. IL-16 is released by a variety of immune (T cells, esinophils, and dendritic cells) and non-immune (fibroblasts, epithelial, and neurona) cells. In the non-diseased state, IL-16 mRNA is almost exclusively expressed on lymphatic tissue, and high levels in T cells. During inflammation, IL-16 is synthesized in a number of other tissues.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Bos indicus (zebu), Bos taurus (cattle)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

13.3 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POTEB3 (NM_207355) Human Over-expression Lysate
LC403978 20 µg

POTEB3 (NM_207355) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS620338 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Biotin Conjugated Glycine max Lectin (Soybean) -SBA-
BA-1301-2 2 mg

Biotin Conjugated Glycine max Lectin (Soybean) -SBA-

Sign In for Pricing
View Details
SOX2 Human Gene Knockout Kit (CRISPR)
KN400757 1 Kit

SOX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS700286 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS642561 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details