Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IL-1 alpha Recombinant Protein

The Bovine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 alpha Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK) (Gene ID: 281250) . For research use only.

Product Specifications

Background

IL-1α is produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the well characterized members of the IL-1-like cytokines play key roles in the development and regulation of inflammation. IL-1α, IL-1β, and IL-18 (IL-1F4) are well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an 'alarmin' released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Bison bison bison (American buffalo), Bos indicus (zebu), Bos javanicus (banteng), Bos taurus (cattle)

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Beta-1-syntrophin ELISA Kit
E14B0972-01 48 Well

Sheep Beta-1-syntrophin ELISA Kit

Ask
View Details
Sheep Beta-1-syntrophin ELISA Kit
E14B0972-02 96 Well

Sheep Beta-1-syntrophin ELISA Kit

Ask
View Details
NDUFAF7 CRISPR Activation Plasmid (h)
sc-412538-ACT 20 µg

NDUFAF7 CRISPR Activation Plasmid (h)

Ask
View Details
ACO1 Antibody
E38PZ0004 100ul

ACO1 Antibody

Ask
View Details
ASCL2 Protein Lysate (Human) with C-Ha Tag
12526031 100 μg

ASCL2 Protein Lysate (Human) with C-Ha Tag

Ask
View Details
AIDA-1 Double Nickase Plasmid (h2)
sc-404523-NIC-2 20 µg

AIDA-1 Double Nickase Plasmid (h2)

Ask
View Details