Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CXCL10 (IP-10) Recombinant Protein

The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107) . For research use only.

Product Specifications

Background

CXCL10, also known as Interferon gamma-induced protein 10 or small-inducible cytokine B10, is a member of the C-X-C chemokine family. CXCL10 is secreted by several cell types in response to IFN-gamma. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes/macrophages, T cells, NK cells, and dendritic cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. There have been 17 different C-X-C chemokines described in mammals, that are subdivided into two categories, those with a specific amino acid sequence (or motif) of glutamic acid-leucine-arginine (or ELR for short) immediately before the first cysteine of the C-X-C motif (ELR-positive), and those without an ELR motif (ELR-negative) . ELR-positive C-X-C chemokines specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. C-X-C chemokines that lack the ELR motif are chemoattractant for lymphocytes. CXCL10 elicits its effects by binding to the cell surface chemokine receptor CXCR3.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Bison bison bison (American buffalo), Bos grunniens (domestic yak), Bos indicus (zebu), Bos javanicus (banteng), Bos mutus (wild yak), Bos taurus (cattle)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

14.9 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog