Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Egyptian Rousette Bat M-CSF Recombinant Protein

The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162) ) (Gene ID: 107516132) . For research use only.

Product Specifications

Background

M-CSF (Macrophage colony-stimulating factor), also known as CSF-1, is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. M-CSF enhances expression of differentiation antigens and stimulates chemotactic, phagocytic and the killing activities of monocytes. M-CSF also stimulates production of several cytokines, including GM- CSF, G-CSF and IL-6 by priming monocytes. It also stimulates production and secretion of IL-8 and reactive nitrogen intermediates. In addition to the stimulation of hematopoiesis, M-CSF also stimulates differentiation and proliferation of osteoclast progenitor cells and cytotrophoblasts.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Rousettus aegyptiacus (Egyptian rousette)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

18.8 kDa

Storage Temperature

-20°C

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal JAM-B/VE-JAM Antibody (988934) [CoraFluor 1]
FAB10743CL1 0.1 mL

Mouse Monoclonal JAM-B/VE-JAM Antibody (988934) [CoraFluor 1]

Ask
View Details
PSD-95 Polyclonal Antibody
JOT-AP07447-01 50ul

PSD-95 Polyclonal Antibody

Ask
View Details
PSD-95 Polyclonal Antibody
JOT-AP07447-02 100ul

PSD-95 Polyclonal Antibody

Ask
View Details
SORBS2 Rabbit pAb
E47R4905 100 µL

SORBS2 Rabbit pAb

Ask
View Details
RPAIN (NM_001160266) Human Tagged ORF Clone
RC228084 10 µg

RPAIN (NM_001160266) Human Tagged ORF Clone

Ask
View Details