Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine VEGF-A Recombinant Protein

The Canine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Canine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 22.0 kDa) (Amino Acid Sequence: APMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKKSIRGKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (188) ) (Gene ID: 403802) . For research use only.

Product Specifications

Background

VEGF proteins stimulate vasculogenesis and angiogenesis. They are part of the system that restores the oxygen supply to tissues when blood circulation is inadequate. The normal function of VEGF proteins is to create new blood vessels during embryonic development, new blood vessels after injury, muscle following exercise, and new vessels (collateral circulation) to bypass blocked vessels. The VEGF family has six members, including VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and Placental Growth Factor (PGF) . Activity of VEGF-A, as its name implies, has been studied mostly on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g., stimulation monocyte/macrophage migration, neurons, cancer cells, kidney epithelial cells) . In vitro, VEGF-A has been shown to stimulate endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor (VPF) .

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Canis lupus dingo (dingo), Canis lupus familiaris (dog), Nyctereutes procyonoides (raccoon dog), Vulpes lagopus (Arctic fox), Vulpes vulpes (red fox)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

22.0 kDa

Storage Temperature

-20°C

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Oncostatin M (OSM) ELISA Kit
DLR-OSM-Mu-01 48 Tests

Mouse Oncostatin M (OSM) ELISA Kit

Sign In for Pricing
View Details
Mouse Oncostatin M (OSM) ELISA Kit
DLR-OSM-Mu-02 96 Tests

Mouse Oncostatin M (OSM) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human RPGRIP1L Protein, N-His
bs-103437P-01 20 µg

Recombinant Human RPGRIP1L Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RPGRIP1L Protein, N-His
bs-103437P-02 50 µg

Recombinant Human RPGRIP1L Protein, N-His

Sign In for Pricing
View Details
Fn1 Mouse shRNA Plasmid (Locus ID 14268)
TL500724 1 Kit

Fn1 Mouse shRNA Plasmid (Locus ID 14268)

Sign In for Pricing
View Details
EAR1 siRNA (Mouse)
orb1848172-01 15 nmol

EAR1 siRNA (Mouse)

Sign In for Pricing
View Details