Equine CCL5 (RANTES) Recombinant Protein

The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925) . For research use only.

Product Specifications

Background

CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine subfamily. There are at least 27 distinct members of the C-C subgroup reported for mammals. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer.

Applications

Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control

Homology

Equus caballus (horse)

Purity

>98% as visualized by SDS-PAGE analysis.

Molecular Weight

7.9 kDa

Storage Temperature

-20°C

Equine CCL5 (RANTES) Recombinant Protein

Product Specifications

Background

Applications

Homology

Purity

Molecular Weight

Storage Temperature

Available Sizes

Explore Other Products

PIAS4 Antibody / PIASg

Rabbit Polyclonal PRPSAP2 Antibody [Alexa Fluor 350]

Anti-Styk1 (4A4)

PPP4R2 Antibody

PPP4R2 Antibody

Human PPP6R1 Pre-designed siRNA Set B