Equine CCL5 (RANTES) Recombinant Protein
The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925) . For research use only.
Product Specifications
Background
CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine subfamily. There are at least 27 distinct members of the C-C subgroup reported for mammals. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer.
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Equus caballus (horse)
Purity
>98% as visualized by SDS-PAGE analysis.
Molecular Weight
7.9 kDa
Storage Temperature
-20°C
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CS-O-60047 1 Each
3â2-Azido-3â2-deoxythymidine 5â2-Monophosphate Sodium
Sign In for Pricing
View Details 
