Equine CCL5 (RANTES) Recombinant Protein
The Equine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS) (Gene ID: 100033925) . For research use only.
Product Specifications
Background
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Equus caballus (horse)
Purity
>98% as visualized by SDS-PAGE analysis.
Molecular Weight
7.9 kDa
Storage Temperature
-20°C
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog