Swine CXCL9 (MIG) Recombinant Protein

The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104) ) (Gene ID: 100135681) . For research use only.

Product Specifications

Background

CXCL9 belongs to the CXC chemokine family. It is also commonly known as Monokine Induced by Gamma interferon (MIG) . CXCL9 is a T-cell chemoattractant induced by IFN gamma. It is closely related to two other CXC chemokines -CXCL10 and CXCL11.