Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase 12 (CDK12), partial

Product Specifications

Product Name Alternative

Cdc2-related kinase, arginine/serine-rich; Cell division cycle 2-related protein kinase 7; Cell division protein kinase 12

Abbreviation

Recombinant Human CDK12 protein, partial

Gene Name

CDK12

UniProt

Q9NYV4

Expression Region

727-1020aa

Organism

Homo sapiens (Human)

Target Sequence

FDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Cyclin-dependent kinase that phosphorylates the C-terminal domain (CTD) of the large subunit of RNA polymerase II (POLR2A), thereby acting as a key regulator of transcription elongation. Regulates the expression of genes involved in DNA repair and is required for the maintenance of genomic stability. Preferentially phosphorylates 'Ser-5' in CTD repeats that are already phosphorylated at 'Ser-7', but can also phosphorylate 'Ser-2'. Required for RNA splicing, possibly by phosphorylating SRSF1/SF2. Involved in regulation of MAP kinase activity, possibly leading to affect the response to estrogen inhibitors

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.5

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS14P10 Adenovirus (Human)
42095051 1.0 mL

RPS14P10 Adenovirus (Human)

Sign In for Pricing
View Details
TACC1 (Transforming Acidic Coiled-coil-Containing Protein 1)
493296 100 µL

TACC1 (Transforming Acidic Coiled-coil-Containing Protein 1)

Sign In for Pricing
View Details
Anti-SHP2 (N-terminal region) Antibody
SM1631 100 µL

Anti-SHP2 (N-terminal region) Antibody

Sign In for Pricing
View Details
Mouse Herc4 ELISA KIT
ELI-31662m 96 Tests

Mouse Herc4 ELISA KIT

Sign In for Pricing
View Details
WNT6 antibody
FNab09521 100 µg

WNT6 antibody

Sign In for Pricing
View Details
Arid1a 3'UTR GFP Stable Cell Line
TU152088 1.0 mL

Arid1a 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details