Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adhesion G protein-coupled receptor L3 (ADGRL3), partial

Product Specifications

Product Name Alternative

Calcium-independent alpha-latrotoxin receptor 3; Latrophilin-3; Lectomedin-3

Abbreviation

Recombinant Human ADGRL3 protein, partial

Gene Name

ADGRL3

UniProt

Q9HAR2

Expression Region

20-425aa

Organism

Homo sapiens (Human)

Target Sequence

FSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELERPSVK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Orphan adhesion G-protein coupled receptor (aGPCR), which mediates synapse specificity. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors. ADGRL3 is coupled with different classes of G alpha proteins, such as G (12) /G (13), G (s), G (i) or G (q), depending on the context. Coupling to G (12) /G (13) G proteins, which mediates the activation Rho small GTPases is the most efficient. Following G-protein coupled receptor activation, associates with cell adhesion molecules that are expressed at the surface of adjacent cells to direct synapse specificity. Specifically mediates the establishment of Schaffer-collateral synapses formed by CA3-region axons on CA1-region pyramidal neurons in the hippocampus. Localizes to postsynaptic spines in excitatory synapses in the S.oriens and S.radiatum and interacts with presynaptic cell adhesion molecules FLRT3 and TENM2, promoting synapse formation. Plays a role in the development of glutamatergic synapses in the cortex. Important in determining the connectivity rates between the principal neurons in the cortex

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAP6D1 activation kit by CRISPRa
GA112736 1 Kit

Human MAP6D1 activation kit by CRISPRa

Sign In for Pricing
View Details
Riboflavin Phosphate Sodium Salt (~70%)
TRC-R415000-10G 10 g

Riboflavin Phosphate Sodium Salt (~70%)

Sign In for Pricing
View Details
Human THAP3 activation kit by CRISPRa
GA114003 1 Kit

Human THAP3 activation kit by CRISPRa

Sign In for Pricing
View Details
TCEAL2 (NM_080390) Human Recombinant Protein
TP311139L 1 mg

TCEAL2 (NM_080390) Human Recombinant Protein

Sign In for Pricing
View Details
CDKL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]
TA805552BM 100 µL

CDKL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]

Sign In for Pricing
View Details
Tert-butyl 4-(benzo[b]thiophen-4-yl)piperazine-1-carboxylate
TRC-T676615-500MG 500 mg

Tert-butyl 4-(benzo[b]thiophen-4-yl)piperazine-1-carboxylate

Sign In for Pricing
View Details