Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 1 (CD300LF) (E111A, D116A, W52A), partial

Product Specifications

Product Name Alternative

CLM-1; CD300 antigen-like family member F; Immune receptor expressed on myeloid cells 1 (IREM-1) ; Immunoglobulin superfamily member 13 (IgSF13) ; NK inhibitory receptor; CD300f

Abbreviation

Recombinant Human CD300LF protein (E111A, D116A, W52A), partial

Gene Name

CD300LF

UniProt

Q8TDQ1

Expression Region

1-155aa (E111A, D116A, W52A)

Organism

Homo sapiens (Human)

Target Sequence

MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKL

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diboc Biotin
TRC-D422755-5MG 5 mg

Diboc Biotin

Sign In for Pricing
View Details
Human LHFPL3 activation kit by CRISPRa
GA117827 1 Kit

Human LHFPL3 activation kit by CRISPRa

Sign In for Pricing
View Details
Collagen XV (COL15A1) (NM_001855) Human Recombinant Protein
TP315981M 100 µg

Collagen XV (COL15A1) (NM_001855) Human Recombinant Protein

Sign In for Pricing
View Details
ReadiLink™ Psoralen-A17-Biotin
39052-AAT 1 mg

ReadiLink™ Psoralen-A17-Biotin

Sign In for Pricing
View Details
MFluor™ Violet 450-PEG4-Biotin Conjugate
3116-AAT 1 mg

MFluor™ Violet 450-PEG4-Biotin Conjugate

Sign In for Pricing
View Details
RAB25 Polyclonal Antibody
E-AB-90393-01 60 µL

RAB25 Polyclonal Antibody

Sign In for Pricing
View Details