Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 1 (CD300LF) (E111A, D116A, W52A), partial

Product Specifications

Product Name Alternative

CLM-1; CD300 antigen-like family member F; Immune receptor expressed on myeloid cells 1 (IREM-1) ; Immunoglobulin superfamily member 13 (IgSF13) ; NK inhibitory receptor; CD300f

Abbreviation

Recombinant Human CD300LF protein (E111A, D116A, W52A), partial

Gene Name

CD300LF

UniProt

Q8TDQ1

Expression Region

1-155aa (E111A, D116A, W52A)

Organism

Homo sapiens (Human)

Target Sequence

MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKL

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gal a(1,4)Gal b(1,4)GlcNac b-O-BSA Colloidal Gold Conjugate,  5nm
CCG-1010-5 1 mL

Gal a(1,4)Gal b(1,4)GlcNac b-O-BSA Colloidal Gold Conjugate, 5nm

Sign In for Pricing
View Details
D-Mannose Gel Immobilized Carbohydrates
CG-005-5 5 mL

D-Mannose Gel Immobilized Carbohydrates

Sign In for Pricing
View Details
Rcan3 Mouse Gene Knockout Kit (CRISPR)
KN514605 1 Kit

Rcan3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl Beta-Thioglucopyranoside
TRC-E926995-500MG 500 mg

Ethyl Beta-Thioglucopyranoside

Sign In for Pricing
View Details
FITC Anti-Human CD329 Antibody[K8]
AN00319C-01 20 Tests

FITC Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details
FITC Anti-Human CD329 Antibody[K8]
AN00319C-02 100 Tests

FITC Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details