Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Angiopoietin-related protein 6 (ANGPTL6), partial

Product Specifications

Product Name Alternative

Angiopoietin-like protein 6; Angiopoietin-related growth factor; Angiopoietin-related protein 5

Abbreviation

Recombinant Human ANGPTL6 protein, partial

Gene Name

ANGPTL6

UniProt

Q8NI99

Expression Region

251-470aa

Organism

Homo sapiens (Human)

Target Sequence

TKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWYHACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGGAYSLRKAAMLIRPLKL

Tag

N-terminal ZNRF3-tagged and C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

May play a role in the wound healing process. May promote epidermal proliferation, remodeling and regeneration. May promote the chemotactic activity of endothelial cells and induce neovascularization. May counteract high-fat diet-induced obesity and related insulin resistance through increased energy expenditure

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV18I2 sgRNA CRISPR Lentivector set (Human)
K0988101 3x 1.0 µg

HPV18I2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit
MBS7227634-01 48 Well

Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit

Sign In for Pricing
View Details
Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit
MBS7227634-02 96 Well

Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit

Sign In for Pricing
View Details
Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit
MBS7227634-03 5x 96 Well

Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit

Sign In for Pricing
View Details
Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit
MBS7227634-04 10x 96 Well

Mouse Acidic fibroblast growth factor intracellular-binding protein (FIBP) ELISA Kit

Sign In for Pricing
View Details
MPP1 Antibody
MBS5312366-01 0.1 mL

MPP1 Antibody

Sign In for Pricing
View Details