Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Non-selective voltage-gated ion channel VDAC2 (Vdac2), partial

Product Specifications

Product Name Alternative

Outer mitochondrial membrane protein porin 2; Voltage-dependent anion-selective channel protein 6

Abbreviation

Recombinant Mouse Vdac2 protein, partial

Gene Name

Vdac2

UniProt

Q60930

Expression Region

1-37aa

Organism

Mus musculus (Mouse)

Target Sequence

MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGFG

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane. The channel adopts an open conformation at zero mV and a closed conformation at both positive and negative potentials. There are two populations of channels; the main that functions in a lower open-state conductance with lower ion selectivity, that switch, in a voltage-dependent manner, from the open to a low-conducting 'closed' state and the other that has a normal ion selectivity in the typical high conductance, 'open' state. Binds various lipids, including the sphingolipid ceramide, the phospholipid phosphatidylcholine, and the sterols cholesterol and oxysterol. Binding of ceramide promotes the mitochondrial outer membrane permeabilization (MOMP) apoptotic pathway

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cellular Apoptosis Susceptibility Rabbit mAb
E2R382984 100ul

Cellular Apoptosis Susceptibility Rabbit mAb

Ask
View Details
Anti-HSF4  (3G3)
YF-MA13601 100 ug

Anti-HSF4 (3G3)

Ask
View Details
Spike S1 RBD, Avi-His-tag, Biotin-labeled (SARS-CoV-2) Recombinant
100697-2 50 µg

Spike S1 RBD, Avi-His-tag, Biotin-labeled (SARS-CoV-2) Recombinant

Ask
View Details
MPEG1 siRNA Oligos set (Human)
30348171 3 x 5 nmol

MPEG1 siRNA Oligos set (Human)

Ask
View Details
Ccser2 (NM_028407) Mouse Tagged ORF Clone
MG212742 10 µg

Ccser2 (NM_028407) Mouse Tagged ORF Clone

Ask
View Details
Monkey Creatine Kinase MM isoenzyme (CK-MM) ELISA Kit
MBS7213687-01 48 Well

Monkey Creatine Kinase MM isoenzyme (CK-MM) ELISA Kit

Ask
View Details