Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

Product Specifications

Product Name Alternative

IsaB; SACOL2660

Abbreviation

Recombinant Staphylococcus aureus isaB protein

Gene Name

IsaB

UniProt

Q5HCQ9

Expression Region

37-175aa

Organism

Staphylococcus aureus (strain COL)

Target Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Floor Type Low Speed Refrigerated Centrifuge BCFLR-201
BCFLR-201 1 Unit

Floor Type Low Speed Refrigerated Centrifuge BCFLR-201

Sign In for Pricing
View Details
BAIAP2 Human qPCR Primer Pair (NM_017451)
HP228582 200 Reactions

BAIAP2 Human qPCR Primer Pair (NM_017451)

Sign In for Pricing
View Details
RPL7 (N-term) Rabbit Polyclonal Antibody
AP53723PU-N 400 µL

RPL7 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PPP1R11 activation kit by CRISPRa
GA104808 1 Kit

Human PPP1R11 activation kit by CRISPRa

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL
BNCB1620-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RPB11 (POLR2J) (NM_006234) Human Over-expression Lysate
LC401876 20 µg

RPB11 (POLR2J) (NM_006234) Human Over-expression Lysate

Sign In for Pricing
View Details