Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Immunodominant staphylococcal antigen B (isaB)

Product Specifications

Product Name Alternative

IsaB; SACOL2660

Abbreviation

Recombinant Staphylococcus aureus isaB protein

Gene Name

IsaB

UniProt

Q5HCQ9

Expression Region

37-175aa

Organism

Staphylococcus aureus (strain COL)

Target Sequence

AITPYYTYNGYIGNNANFILDKNFINAIKYDNVKFNGIKLAKTNTIKKVEKYDQTFKGVSAKGNEASQLQFVVKNNISLKDIQKAYGKDLKKENGKTKEADSGIFYYQNAKKTLGIWFVVDHNRVVEVTVGHTPYKTSK

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse S100A6 Protein
PKSM040792 50 µg

Recombinant Mouse S100A6 Protein

Sign In for Pricing
View Details
2-(Hydroxyimino)-3-oxo-pentanedioic Acid 1,5-Diethyl Ester
TRC-H943315-25MG 25 mg

2-(Hydroxyimino)-3-oxo-pentanedioic Acid 1,5-Diethyl Ester

Sign In for Pricing
View Details
APCDD1 (NM_153000) Human Recombinant Protein
TP308639 20 µg

APCDD1 (NM_153000) Human Recombinant Protein

Sign In for Pricing
View Details
D,L-threo-Droxidopa-13C2,15N Hydrochloride
TRC-D689952-1MG 1 mg

D,L-threo-Droxidopa-13C2,15N Hydrochloride

Sign In for Pricing
View Details
Human SNX26 (ARHGAP33) activation kit by CRISPRa
GA114539 1 Kit

Human SNX26 (ARHGAP33) activation kit by CRISPRa

Sign In for Pricing
View Details
Variable Volume Single Channel Micropipette BPIP-511
BPIP-511 1 Unit

Variable Volume Single Channel Micropipette BPIP-511

Sign In for Pricing
View Details