Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Dipeptidase 3 (DPEP3)

Product Specifications

Product Name Alternative

DPEP3; QtsA-14814

Abbreviation

Recombinant Cynomolgus monkey DPEP3 protein

Gene Name

DPEP3

UniProt

Q4R7M2

Expression Region

36-463aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

GETTTGAPRALSTLGFPSPFTTPGVPSTLTTPGLTTPGTTKTLDLRSRAQALMRDFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHSQTSLDRLRDGLVGAQFWSASVSCQTQDQTAVRLALEQIDLIRRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCNTPWAESSTKFTHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLMRRVLEVSRAPVIFSHSAARAVCDNSLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGAGRFPQGLEDVSTYPVLIEELLSRSWSEKELQGVLRGNLLRVFRQAEKVREESRAQSPMEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKWPTNRVPWRS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

Lacks dipeptidase activity and is unable to hydrolyze cystinyl-bis-glycine, leukotriene D4 and the beta-lactam antibiotic imipenem. The absence of activity may be due to the inability of asparagine (instead of aspartate found in DPEP1/2) at position 359 to function as the acid/base catalyst and activate the nucleophilic water/hydroxide. A tyrosine (instead of histidine) at position 269 reduces affinity for the beta zinc and may cause substrate steric hindrance

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACPL2 (PXYLP1) (NM_001037172) Human Over-expression Lysate
LY421929 100 µg

ACPL2 (PXYLP1) (NM_001037172) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Anti-Human CD21 Antibody[HI21a]
E-AB-F1320D-01 20 Tests

PE Anti-Human CD21 Antibody[HI21a]

Sign In for Pricing
View Details
PE Anti-Human CD21 Antibody[HI21a]
E-AB-F1320D-02 100 Tests

PE Anti-Human CD21 Antibody[HI21a]

Sign In for Pricing
View Details
PE Anti-Human CD21 Antibody[HI21a]
E-AB-F1320D-03 2x 100 Tests

PE Anti-Human CD21 Antibody[HI21a]

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF488A conjugate, 0.1mg/mL
BNC882074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488-conjugated GAPDH Monoclonal Antibody
AN00296L-01 25 µL

Elab Fluor® 488-conjugated GAPDH Monoclonal Antibody

Sign In for Pricing
View Details