Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Apolipoprotein C-I (Apoc1)

Product Specifications

Product Name Alternative

Apolipoprotein C1; Liver regeneration-related protein LRRG04

Abbreviation

Recombinant Rat Apoc1 protein

Gene Name

Apoc1

UniProt

P19939

Expression Region

27-88aa

Organism

Rattus norvegicus (Rat)

Target Sequence

APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP) . Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cbll1 (NM_001108018) Rat Tagged ORF Clone
RR200831 10 µg

Cbll1 (NM_001108018) Rat Tagged ORF Clone

Ask
View Details
Lentiviral mouse Tspan7 shRNA (UAS) - Lentiviral mouse Tspan7 shRNA (UAS) (100)
GTR15222738 1 Vial

Lentiviral mouse Tspan7 shRNA (UAS) - Lentiviral mouse Tspan7 shRNA (UAS) (100)

Ask
View Details
Slc38a10 (NM_001164800) Mouse Tagged ORF Clone
MR211603 10 µg

Slc38a10 (NM_001164800) Mouse Tagged ORF Clone

Ask
View Details
CD71 (Transferrin Receptor Protein 1, TR, TfR, TfR1, Trfr, T9, p90, TFRC) discontinued, see C2426-16A
137783 100 µg

CD71 (Transferrin Receptor Protein 1, TR, TfR, TfR1, Trfr, T9, p90, TFRC) discontinued, see C2426-16A

Ask
View Details