Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Prostate-specific antigen (KLK3)

Product Specifications

Product Name Alternative

Gamma-seminoprotein; Kallikrein-3; P-30 antigen; Semenogelase

Abbreviation

Recombinant Human KLK3 protein

Gene Name

KLK3

UniProt

P07288

Expression Region

18-261aa

Organism

Homo sapiens (Human)

Target Sequence

APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal transduction

Relevance

Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP3 Receptor, phosphorylated (Ser1756)
524473-01 100 µL

IP3 Receptor, phosphorylated (Ser1756)

Sign In for Pricing
View Details
IP3 Receptor, phosphorylated (Ser1756)
524473-02 200 µL

IP3 Receptor, phosphorylated (Ser1756)

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb224009-01 30 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb224009-02 50 μL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb224009-03 100 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
orb224009-04 200 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details