Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Natural cytotoxicity triggering receptor 1 (NCR1), partial

Product Specifications

Product Name Alternative

Lymphocyte antigen 94 homolog; NK cell-activating receptor; Natural killer cell p46-related protein

Abbreviation

Recombinant Human NCR1 protein, partial

Gene Name

NCR1

UniProt

O76036

Expression Region

22-258aa

Organism

Homo sapiens (Human)

Target Sequence

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL
BNC470050-100 1x 100 µL

IgA Secretory Component (SC05), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-100 1x 100 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF647 conjugate, 0.1mg/mL
BNC470531-500 1x 500 µL

VEGF-R2 / CD309 / Flk-1 / KDR3 (DC101), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL
BNC942152-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF405S conjugate, 0.1mg/mL
BNC040950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details