Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

Product Specifications

Product Name Alternative

Guca2b

Abbreviation

Recombinant Mouse Guca2b protein

Gene Name

Guca2b

UniProt

O09051

Expression Region

22-106aa

Organism

Mus musculus (Mouse)

Target Sequence

VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal WDFY2 Antibody
NBP3-17455-25ul 25 µL

Rabbit Polyclonal WDFY2 Antibody

Sign In for Pricing
View Details
Nalidixic acid sodium salt
285061-01 25 g

Nalidixic acid sodium salt

Sign In for Pricing
View Details
Nalidixic acid sodium salt
285061-02 50 g

Nalidixic acid sodium salt

Sign In for Pricing
View Details
Nalidixic acid sodium salt
285061-03 100 g

Nalidixic acid sodium salt

Sign In for Pricing
View Details
Nalidixic acid sodium salt
285061-04 250 g

Nalidixic acid sodium salt

Sign In for Pricing
View Details
Nalidixic acid sodium salt
285061-05 500 g

Nalidixic acid sodium salt

Sign In for Pricing
View Details