Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans chitin deacetylase (CDA2)

Product Specifications

Product Name Alternative

CDA2

Abbreviation

Recombinant Candida albicans CDA2 protein

Gene Name

CDA2

UniProt

A0A1D8PRN6

Expression Region

19-367aa

Organism

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Target Sequence

SDLSLRLQSKFMPTSFSPRNIFDTHGPATINSNKEDSSSSSGGGGGSGLPPSPMQFPPKLPFPKWLSDFTGLHEWPDLDPPYIPLDFIDFNKIVNIPIHKQGQCHDTGSNNNNNLTPLSILRTPKACSFDCFNCVEIDDVYTCPKLSQTFDDGPSTSTLKLLQSFNQTGLKTTLFTLGVNIVRFPEIYQQSHFMGHIMGSHTWSHKFLPSLTNQEIISQIEWSIWAMNATSNHLPKWFRPPYGGIDNRIRSILRQFGMQAVLWDFDTFDWKMLGGGGGATSNIRKEEDVFSEVEKFKLTKNNKGLILHHDAIQKTVDVGIMIHEKLLNHDQLTVPLCVGGIDYIKTFPK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Metabolism

Relevance

Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin to form chitosan and acetate. Chitosan is a component of the spore wall

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Glyceric Acid Calcium Salt Dihydrate
TRC-D253085-500MG 500 mg

D-Glyceric Acid Calcium Salt Dihydrate

Sign In for Pricing
View Details
AHA1 (AHSA1) Rabbit Monoclonal Antibody [Clone ID: R01-8D9]
TA421479 100 µL

AHA1 (AHSA1) Rabbit Monoclonal Antibody [Clone ID: R01-8D9]

Sign In for Pricing
View Details
Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G7]
TA808911AM 100 µL

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G7]

Sign In for Pricing
View Details
Human FCRLB activation kit by CRISPRa
GA115020 1 Kit

Human FCRLB activation kit by CRISPRa

Sign In for Pricing
View Details
PIP4P1 antibody
FNab08786 100 µg

PIP4P1 antibody

Sign In for Pricing
View Details
SLC30A7 antibody
FNab09749 100 µg

SLC30A7 antibody

Sign In for Pricing
View Details