Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cadherin-19 (CDH19), partial

Product Specifications

Product Name Alternative

CDH19; CDH7L2; UNQ478/PRO941

Abbreviation

Recombinant Human CDH19 protein, partial

Gene Name

CDH19

UniProt

Q9H159

Expression Region

44-596aa

Organism

Homo sapiens (Human)

Target Sequence

GWVWNQFFVPEEMNTTSHHIGQLRSDLDNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISSKMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNGTITTSNSLDREISAWYNLSITATEKYNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQVIQTISAVDRDESIEEHHFYFNLSVEDTNNSSFTIIDNQDNTAVILTNRTGFNLQEEPVFYISILIADNGIPSLTSTNTLTIHVCDCGDSGSTQTCQYQELVLSMGFKTE

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

91.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIML2 Antibody
KC-2343-01 50 μL

TRIML2 Antibody

Sign In for Pricing
View Details
TRIML2 Antibody
KC-2343-02 100 µL

TRIML2 Antibody

Sign In for Pricing
View Details
TRIML2 Antibody
KC-2343-03 1 mL

TRIML2 Antibody

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]
E-AB-F11140-01 100 µg

AF/LE Purified Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]
E-AB-F11140-02 1 mg

AF/LE Purified Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]
E-AB-F11140-03 5 mg

AF/LE Purified Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]

Sign In for Pricing
View Details