Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-33 (IL33), partial

Product Specifications

Product Name Alternative

Interleukin-1 family member 11; Nuclear factor from high endothelial venules

Abbreviation

Recombinant Human IL33 protein, partial

Gene Name

IL33

UniProt

O95760

Expression Region

109-270aa

Organism

Homo sapiens (Human)

Target Sequence

HDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as an enhancer of polarization of alternatively activated macrophages. Acts as a chemoattractant for Th2 cells, and may function as an 'alarmin', that amplifies immune responses during tissue injury. Induces rapid UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTDR1 Recombinant Protein (Human)
RP027370 100 µg

RTDR1 Recombinant Protein (Human)

Sign In for Pricing
View Details
CTRC (Detection) Mouse Monoclonal Antibody
orb3073334-01 100 µg

CTRC (Detection) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CTRC (Detection) Mouse Monoclonal Antibody
orb3073334-02 1 mg

CTRC (Detection) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-EPHA7 (Tyr791) Antibody
AF3945-01 100 µL

Phospho-EPHA7 (Tyr791) Antibody

Sign In for Pricing
View Details
Phospho-EPHA7 (Tyr791) Antibody
AF3945-02 200 µL

Phospho-EPHA7 (Tyr791) Antibody

Sign In for Pricing
View Details
DIO3 ORF Vector (Human) (pORF)
ORF003119 1.0 µg DNA

DIO3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details