Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial

Product Specifications

Product Name Alternative

Cytokine receptor-like 2; IL-XR; Thymic stromal lymphopoietin protein receptor

Abbreviation

Recombinant Human CRLF2 protein, partial

Gene Name

CRLF2

UniProt

Q9HC73

Expression Region

25-231aa

Organism

Homo sapiens (Human)

Target Sequence

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor for thymic stromal lymphopoietin (TSLP) . Forms a functional complex with TSLP and IL7R which is capable of stimulating cell proliferation through activation of STAT3 and STAT5. Also activates JAK2. Implicated in the development of the hematopoietic system

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD94 (KLRD1) (BC028009) Human Untagged Clone
SC122242 10 µg

CD94 (KLRD1) (BC028009) Human Untagged Clone

Sign In for Pricing
View Details
Ica1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3461407 1.0 µg DNA

Ica1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cadherin-1 (CDH1) Antibody
abx240004 100 µg

Cadherin-1 (CDH1) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal WBSCR22 Antibody
NBP2-13520 0.1 mL

Rabbit Polyclonal WBSCR22 Antibody

Sign In for Pricing
View Details
KCNQ5 (Potassium Voltage-gated Channel Subfamily KQT Member 5, KQT-like 5, Potassium Channel Subunit alpha KvLQT5, Voltage-gated Potassium Channel Subunit Kv7.5) (HRP)
MBS6153186-01 0.1 mL

KCNQ5 (Potassium Voltage-gated Channel Subfamily KQT Member 5, KQT-like 5, Potassium Channel Subunit alpha KvLQT5, Voltage-gated Potassium Channel Subunit Kv7.5) (HRP)

Sign In for Pricing
View Details
KCNQ5 (Potassium Voltage-gated Channel Subfamily KQT Member 5, KQT-like 5, Potassium Channel Subunit alpha KvLQT5, Voltage-gated Potassium Channel Subunit Kv7.5) (HRP)
MBS6153186-02 5x 0.1 mL

KCNQ5 (Potassium Voltage-gated Channel Subfamily KQT Member 5, KQT-like 5, Potassium Channel Subunit alpha KvLQT5, Voltage-gated Potassium Channel Subunit Kv7.5) (HRP)

Sign In for Pricing
View Details