Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bone morphogenetic protein 7 (Bmp7)

Product Specifications

Product Name Alternative

Osteogenic protein 1

Abbreviation

Recombinant Mouse Bmp7 protein

Gene Name

Bmp7

UniProt

P23359

Expression Region

292-430aa

Organism

Mus musculus (Mouse)

Target Sequence

STGGKQRSQNRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

Tag

C-terminal 10xHis-HSA-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal transduction

Relevance

Growth factor of the TGF-beta superfamily that plays important role in various biological processes, including embryogenesis, hematopoiesis, neurogenesis and skeletal morphogenesis. Initiates the canonical BMP signaling cascade by associating with type I receptor ACVR1 and type II receptor ACVR2A. Once all three components are bound together in a complex at the cell surface, ACVR2A phosphorylates and activates ACVR1. In turn, ACVR1 propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. For specific functions such as growth cone collapse in developing spinal neurons and chemotaxis of monocytes, also uses BMPR2 as type II receptor. Can also signal through non-canonical pathways such as P38 MAP kinase signaling cascade that promotes brown adipocyte differentiation through activation of target genes, including members of the SOX family of transcription factors. Promotes the expression of HAMP, this is repressed by its interaction with ERFE

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

83.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR1E2
526318-01 100 µL

OR1E2

Sign In for Pricing
View Details
OR1E2
526318-02 200 µL

OR1E2

Sign In for Pricing
View Details
ICA1 Rabbit Polyclonal Antibody
orb2950783-01 50 µg

ICA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ICA1 Rabbit Polyclonal Antibody
orb2950783-02 100 µg

ICA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRCA2 Rabbit Polyclonal Antibody
APRab07643-01 20 µL

BRCA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRCA2 Rabbit Polyclonal Antibody
APRab07643-02 50 µL

BRCA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details