Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)

Product Specifications

Product Name Alternative

425O18-1; Angiopoietin-like protein 4; Fasting-induced adipose factor; Hepatic fibrinogen/angiopoietin-related protein; Secreted protein Bk89

Abbreviation

Recombinant Mouse Angptl4 protein

Gene Name

Angptl4

UniProt

Q9Z1P8

Expression Region

24-410aa

Organism

Mus musculus (Mouse)

Target Sequence

QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

Tag

N-terminal HSA-tagged and C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal transduction

Relevance

Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro) . Depending on context, may modulate tumor-related angiogenesis (Probable)

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

111.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fbp2 ORF Vector (Rat) (pORF)
20285016 1.0 µg DNA

Fbp2 ORF Vector (Rat) (pORF)

Ask
View Details
ERMAP Mouse Monoclonal Antibody [Clone ID: OTIC8]
TA500911S 30 µL

ERMAP Mouse Monoclonal Antibody [Clone ID: OTIC8]

Ask
View Details
PPRC1, CT (PPRC1, KIAA0595, Peroxisome proliferator-activated receptor gamma coactivator-related protein 1, PGC-1-related coactivator) (Biotin) discontinued
040370-Biotin 200 µL

PPRC1, CT (PPRC1, KIAA0595, Peroxisome proliferator-activated receptor gamma coactivator-related protein 1, PGC-1-related coactivator) (Biotin) discontinued

Ask
View Details
Guinea pig Phosphoinositide-specific phospholipase C ELISA Kit
MBS722783-01 48 Well

Guinea pig Phosphoinositide-specific phospholipase C ELISA Kit

Ask
View Details
Guinea pig Phosphoinositide-specific phospholipase C ELISA Kit
MBS722783-02 96 Well

Guinea pig Phosphoinositide-specific phospholipase C ELISA Kit

Ask
View Details
Guinea pig Phosphoinositide-specific phospholipase C ELISA Kit
MBS722783-03 5x 96 Well

Guinea pig Phosphoinositide-specific phospholipase C ELISA Kit

Ask
View Details