Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Abbreviation

Recombinant Bovine EGF protein, partial

Gene Name

EGF

UniProt

XP_024849546.1

Expression Region

990-1046aa

Organism

Bos taurus (Bovine)

Target Sequence

FPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPHSAGRGH

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FGF R1 Antibody (M17D10) [FITC]
NB100-2080F 0.1 mL

Mouse Monoclonal FGF R1 Antibody (M17D10) [FITC]

Sign In for Pricing
View Details
Bis (2-ethylhexyl) 4-Bromoisophthalate
442803-01 5 mg

Bis (2-ethylhexyl) 4-Bromoisophthalate

Sign In for Pricing
View Details
Bis (2-ethylhexyl) 4-Bromoisophthalate
442803-02 10 mg

Bis (2-ethylhexyl) 4-Bromoisophthalate

Sign In for Pricing
View Details
Mouse Acetylcholine Receptor Subunit Epsilon (CHRNE) ELISA Development Kit
abx378614-01 5x 96 Tests

Mouse Acetylcholine Receptor Subunit Epsilon (CHRNE) ELISA Development Kit

Sign In for Pricing
View Details
Mouse Acetylcholine Receptor Subunit Epsilon (CHRNE) ELISA Development Kit
abx378614-02 15x 96 Tests

Mouse Acetylcholine Receptor Subunit Epsilon (CHRNE) ELISA Development Kit

Sign In for Pricing
View Details
SUGT1P4-STRA6LP-CCDC180 Human siRNA Oligo Duplex (Locus ID 57653)
SR311636 1 Kit

SUGT1P4-STRA6LP-CCDC180 Human siRNA Oligo Duplex (Locus ID 57653)

Sign In for Pricing
View Details