Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine pro-epidermal growth factor (EGF), partial

Product Specifications

Abbreviation

Recombinant Bovine EGF protein, partial

Gene Name

EGF

UniProt

XP_024849546.1

Expression Region

984-1040aa

Organism

Bos taurus (Bovine)

Target Sequence

NFLKKCFPEYTPNFEGYCLNGHVCIYFGIANLFSCHCPIGYPGKRGEYIDFDGWDPH

Tag

N-terminal 6xHis-TrxA-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal transduction

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human SYT1 (Synaptotagmin 1) Expressed in vitro E.coli expression system, Full Length
MPX3895K Each

Magic™ Membrane Protein Human SYT1 (Synaptotagmin 1) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Pribolab® Fluorescence quantitative Detection System
HWEQ-LFR 6100 1 Unit

Pribolab® Fluorescence quantitative Detection System

Sign In for Pricing
View Details
Recombinant Mouse Il10 protein, His-tagged
Il10-2566M 25 µg

Recombinant Mouse Il10 protein, His-tagged

Sign In for Pricing
View Details
Anti-SSTR3 Antibody (R3J39)
RHE00902 100 μg

Anti-SSTR3 Antibody (R3J39)

Sign In for Pricing
View Details
Rabbit Anti-Human MAF1 pAb
PA9179-01 50 μL

Rabbit Anti-Human MAF1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human MAF1 pAb
PA9179-02 100 μL

Rabbit Anti-Human MAF1 pAb

Sign In for Pricing
View Details