Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Product Specifications

Product Name Alternative

68 kDa TATA-binding protein-associated factor; RNA-binding protein 56

Abbreviation

Recombinant Human TAF15 protein, partial

Gene Name

TAF15

UniProt

Q92804

Expression Region

305-592aa

Organism

Homo sapiens (Human)

Target Sequence

GKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRGRGGFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSSGGGYSGDRSGGGYGGDRSGGGYGGDRGGGYGGDRGGGYGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGDRSGGGYGGDRGGGYGGDRGGYGGKMGGRNDYRNDQRNRPY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

RNA and ssDNA-binding protein that may play specific roles during transcription initiation at distinct promoters. Binds to ssRNA containing the consensus sequence 5'-AGGUAA-3'. Can enter the preinitiation complex together with the RNA polymerase II (Pol II)

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform Long

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus Suis rpsO Protein (aa 1-89) (strain 98HAH33)
VAng-Cr8360-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Suis rpsO Protein (aa 1-89) (strain 98HAH33)

Sign In for Pricing
View Details
GPCR RTA/MRGPRF Polyclonal Antibody, PE-Cy5 Conjugated
bs-15372R-PE-Cy5 100 µL

GPCR RTA/MRGPRF Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Human CNDP1 Protein, His Tag
KMPH1188 10 µg

Human CNDP1 Protein, His Tag

Sign In for Pricing
View Details
AGPAT3 Antibody
MBS853136-01 0.1 mg

AGPAT3 Antibody

Sign In for Pricing
View Details
AGPAT3 Antibody
MBS853136-02 0.1 mL (AF405L)

AGPAT3 Antibody

Sign In for Pricing
View Details
AGPAT3 Antibody
MBS853136-03 0.1 mL (AF405S)

AGPAT3 Antibody

Sign In for Pricing
View Details