Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon gamma receptor 1 (Ifngr1), partial

Product Specifications

Product Name Alternative

Interferon gamma receptor alpha-chain

Abbreviation

Recombinant Mouse Ifngr1 protein, partial

Gene Name

Ifngr1

UniProt

P15261

Expression Region

26-254aa

Organism

Mus musculus (Mouse)

Target Sequence

ALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDS

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor subunit for interferon gamma/INFG that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation (, PubMed:20926559, PubMed:27286456) . Associates with transmembrane accessory factor IFNGR2 to form a functional receptor. Upon ligand binding, the intracellular domain of IFNGR1 opens out to allow association of downstream signaling components JAK1 and JAK2. In turn, activated JAK1 phosphorylates IFNGR1 to form a docking site for STAT1. Subsequent phosphorylation of STAT1 leads to its dimerization, translocation to the nucleus, and stimulation of target gene transcription. STAT3 can also be activated in a similar manner although activation seems weaker. IFNGR1 intracellular domain phosphorylation also provides a docking site for SOCS1 that regulates the JAK-STAT pathway by competing with STAT1 binding to IFNGR1

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Fluoro-1H-indol-5-amine
PC102283-01 100 mg

6-Fluoro-1H-indol-5-amine

Sign In for Pricing
View Details
6-Fluoro-1H-indol-5-amine
PC102283-02 1 g

6-Fluoro-1H-indol-5-amine

Sign In for Pricing
View Details
Entamoeba Histolytica
15020-1.0mg 1 mg

Entamoeba Histolytica

Sign In for Pricing
View Details
Rabbit anti NFkB p105 (pSer932)
MBS225296-01 0.05 mL

Rabbit anti NFkB p105 (pSer932)

Sign In for Pricing
View Details
Rabbit anti NFkB p105 (pSer932)
MBS225296-02 5x 0.05 mL

Rabbit anti NFkB p105 (pSer932)

Sign In for Pricing
View Details
Rabbit anti-MPP8 Antibody, Affinity Purified
A303-051A-T 10 µg

Rabbit anti-MPP8 Antibody, Affinity Purified

Sign In for Pricing
View Details