Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Product Specifications

Product Name Alternative

68 kDa TATA-binding protein-associated factor; RNA-binding protein 56

Abbreviation

Recombinant Human TAF15 protein, partial

Gene Name

TAF15

UniProt

Q92804-1

Expression Region

1-119aa

Organism

Homo sapiens (Human)

Target Sequence

MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQ

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform Long

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CASP14 ELISA Kit
EF013491 96 Tests

Mouse CASP14 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Feline Immunodeficiency Virus Antibody (5A1) [Alexa Fluor 647]
NB100-64581AF647 0.1 mL

Mouse Monoclonal Feline Immunodeficiency Virus Antibody (5A1) [Alexa Fluor 647]

Sign In for Pricing
View Details
Lentiviral mouse Dnajb14 shRNA (UAS) - Lentiviral mouse Dnajb14 shRNA (UAS, iRFP) plasmid
GTR15177796 1 Vial

Lentiviral mouse Dnajb14 shRNA (UAS) - Lentiviral mouse Dnajb14 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
RTN3 (NM_006054) Human Over-expression Lysate
LC416906 20 µg

RTN3 (NM_006054) Human Over-expression Lysate

Sign In for Pricing
View Details
Malachite Green Oxalate, Certified 98+% (Dye content)
239600-01 100 g

Malachite Green Oxalate, Certified 98+% (Dye content)

Sign In for Pricing
View Details
Malachite Green Oxalate, Certified 98+% (Dye content)
239600-02 250 g

Malachite Green Oxalate, Certified 98+% (Dye content)

Sign In for Pricing
View Details