Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interferon gamma receptor 1 (IFNGR1), partial

Product Specifications

Product Name Alternative

Interferon gamma receptor alpha-chain

Abbreviation

Recombinant Rhesus macaque IFNGR1 protein, partial

Gene Name

IFNGR1

UniProt

A0A5F8A7G4

Expression Region

18-246aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

EMGTADLGPSSVPIPTNVTIESYNMNTIVYWEYQNMPQDPVFTVEVKNYGVKNAEWIDACISISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSKEFAVCRDGKIGPPKLDIRKEEKQIIIDVFHPSVFVNGEEQEVDYDPETTCYIKVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLVIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGS

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ColorTag pipette marking rings, for all Eppendorf 5 mL pipette lower parts, and Easypet 3 pipette controller aspirating cone, light green, inner diameter: 27 mm, 5 pcs.
4031-6201 5 Pieces

ColorTag pipette marking rings, for all Eppendorf 5 mL pipette lower parts, and Easypet 3 pipette controller aspirating cone, light green, inner diameter: 27 mm, 5 pcs.

Sign In for Pricing
View Details
Mouse Activating signal cointegor 1 complex subunit 2 (ASCC2) ELISA kit
GTR10414183 96 Well

Mouse Activating signal cointegor 1 complex subunit 2 (ASCC2) ELISA kit

Sign In for Pricing
View Details
Vmn1r74 (NM_134206) Mouse Untagged Clone
MC212389 10 µg

Vmn1r74 (NM_134206) Mouse Untagged Clone

Sign In for Pricing
View Details
Human SERINC1 Pre-designed siRNA Set A
SI014547A 1 Each

Human SERINC1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Fxyd1 shRNA (UAS) - Lentiviral mouse Fxyd1 shRNA (UAS) plasmid
GTR15245527 1 Vial

Lentiviral mouse Fxyd1 shRNA (UAS) - Lentiviral mouse Fxyd1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Benzyl- (2-chloro-benzyl) -amine
sc-285005 1 g

Benzyl- (2-chloro-benzyl) -amine

Sign In for Pricing
View Details