Recombinant Mouse Cerebellin-4 (Cbln4)

QNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLLGGWQYSTFSGFLVFPL

Acts as a synaptic organizer in specific subsets of neurons in the brain. Essential for the formation and maintenance of inhibitory GABAergic synapses. Promotes the development of dendrite-targeting inhibitory GABAergic synapses made by somatostatin-positive interneurons. May contribute to the function of ventral medial habenula region of the brain implicated in the regulation of anxiety-related behaviors. May play a role in CBLN3 export from the endoplasmic reticulum and secretion

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.