Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Remodeling and spacing factor 1 (RSF1), partial

Product Specifications

Product Name Alternative

HBV pX-associated protein 8; Hepatitis B virus X-associated protein; p325 subunit of RSF chromatin-remodeling complex

Abbreviation

Recombinant Human RSF1 protein, partial

Gene Name

RSF1

UniProt

Q96T23

Expression Region

1343-1441aa

Organism

Homo sapiens (Human)

Target Sequence

IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Regulatory subunit of the ATP-dependent RSF-1 and RSF-5 ISWI chromatin-remodeling complexes, which form ordered nucleosome arrays on chromatin and facilitate access to DNA during DNA-templated processes such as DNA replication, transcription, and repair. Binds to core histones together with SMARCA5, and is required for the assembly of regular nucleosome arrays by the RSF-5 ISWI chromatin-remodeling complex. Directly stimulates the ATPase activity of SMARCA1 and SMARCA5 in the RSF-1 and RSF-5 ISWI chromatin-remodeling complexes, respectively. The RSF-1 ISWI chromatin remodeling complex has a lower ATP hydrolysis rate than the RSF-5 ISWI chromatin-remodeling complex. The complexes do not have the ability to slide mononucleosomes to the center of a DNA template. Facilitates transcription of hepatitis B virus (HBV) genes by the pX transcription activator. In case of infection by HBV, together with pX, it represses TNF-alpha induced NF-kappa-B transcription activation. Represses transcription when artificially recruited to chromatin by fusion to a heterogeneous DNA binding domain

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NID67 shRNA (m) Lentiviral Particles
sc-149971-V 200 µL

NID67 shRNA (m) Lentiviral Particles

Ask
View Details
Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)
MBS1299107-01 0.02 mg (E-Coli)

Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)

Ask
View Details
Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)
MBS1299107-02 0.1 mg (E-Coli)

Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)

Ask
View Details
Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)
MBS1299107-03 0.02 mg (Yeast)

Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)

Ask
View Details
Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)
MBS1299107-04 0.1 mg (Yeast)

Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)

Ask
View Details
Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)
MBS1299107-05 0.02 mg (Baculovirus)

Recombinant Chaetomium globosum UPF0499 protein CHGG_06021 (CHGG_06021)

Ask
View Details