Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Latent-transforming growth factor beta-binding protein 4 (LTBP4), partial

Product Specifications

Abbreviation

Recombinant Human LTBP4 protein, partial

Gene Name

LTBP4

UniProt

Q8N2S1

Expression Region

1100-1399aa

Organism

Homo sapiens (Human)

Target Sequence

GVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRTSAGTFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Key regulator of transforming growth factor beta (TGFB1, TGFB2 and TGFB3) that controls TGF-beta activation by maintaining it in a latent state during storage in extracellular space. Associates specifically via disulfide bonds with the Latency-associated peptide (LAP), which is the regulatory chain of TGF-beta, and regulates integrin-dependent activation of TGF-beta

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS8P5 sgRNA CRISPR Lentivector (Human) (Target 1)
K2019302 1.0 µg DNA

RPS8P5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mucin 1 (MUC1 Glycoprotein, CD227) (AP) discontinued
M4700-05-AP 100 µL

Mucin 1 (MUC1 Glycoprotein, CD227) (AP) discontinued

Sign In for Pricing
View Details
CD105 (Endoglin, gp160, TGF beta1,3 Receptor) (Biotin)
C2446-55-Biotin 100 µL

CD105 (Endoglin, gp160, TGF beta1,3 Receptor) (Biotin)

Sign In for Pricing
View Details
Dipk2b Mouse Gene Knockout Kit (CRISPR)
KN500405 1 Kit

Dipk2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat Interleukin 33 (IL33) ELISA Kit
RD-IL33-Ra-48Tests 48 Tests

Rat Interleukin 33 (IL33) ELISA Kit

Sign In for Pricing
View Details
4-Nitrophenylacetic acid
OR3989-01 1 g

4-Nitrophenylacetic acid

Sign In for Pricing
View Details