Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1), partial
Product Specifications
Product Name Alternative
Copper transporter 1; Solute carrier family 31 member 1
Abbreviation
Recombinant Mouse Slc31a1 protein, partial
Gene Name
Slc31a1
UniProt
Q8K211
Expression Region
1-74aa
Organism
Mus musculus (Mouse)
Target Sequence
MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNVNLLFSGLVINTPGE
Tag
C-terminal 6xHis-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Neuroscience
Relevance
Uniporter that mediates the transport of copper (1+) from the extracellular space to the cytoplasm, across the plasma membrane. Then, delivers directly copper (1+) to specific chaperone such as ATOX1, via a copper (1+) - mediated transient interaction between the C-terminal domain and a copper (1+) chaperone, thus controlling intracellular copper (1+) levels. May function in copper (1+) import from the apical membrane thus may drive intestinal copper absorption. The copper (1+) transport mechanism is sodium-independent, saturable and of high-affinity. Also mediates the uptake of silver (1+) . May function in the influx of the platinum-containing chemotherapeutic agents. The platinum-containing chemotherapeutic agents uptake is saturable. Also participates in the first step of copper (2+) acquisition by cells through a direct transfer of copper (2+) from copper (2+) carriers in blood, such as ALB to the N-terminal domain of SLC31A1, leading to copper (2+) reduction and probably followed by copper (1+) stabilization. In addition, functions as a redox sensor to promote angiogenesis in endothelial cells, in a copper (1+) transport independent manner, by transmitting the VEGF-induced ROS signal through a sulfenylation at Cys-195 leading to a subsequent disulfide bond formation between SLC31A1 and KDR. The SLC31A1-KDR complex is then co-internalized to early endosomes, driving a sustained VEGFR2 signaling
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
15.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial of BC004372
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items