Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Apolipoprotein A-I (Apoa1), partial

Product Specifications

Product Name Alternative

Apolipoprotein A1

Abbreviation

Recombinant Rat Apoa1 protein, partial

Gene Name

Apoa1

UniProt

P04639

Expression Region

25-259aa

Organism

Rattus norvegicus (Rat)

Target Sequence

DEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESSTLGKQLNLNLLDNWDTLGSTVGRLQEQLGPVTQEFWANLEKETDWLRNEMNKDLENVKQKMQPHLDEFQEKWNEEVEAYRQKLEPLGTELHKNAKEMQRHLKVVAEEFRDRMRVNADALRAKFGLYSDQMRENLAQRLTEIKNHPTLIEYHTKASDHLKTLGEKAKPALDDLGQGLMPVLEAWKAKIMSMIDEAKKKLNA

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT) . As part of the SPAP complex, activates spermatozoa motility

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Myelin Basic Protein Rabbit pAb
GB11226-1 100 μL

Anti-Myelin Basic Protein Rabbit pAb

Sign In for Pricing
View Details
Human Interferon-induced protein with tetratricopeptide repeats 1 ELISA Kit
MBS9427374-01 96 Tests

Human Interferon-induced protein with tetratricopeptide repeats 1 ELISA Kit

Sign In for Pricing
View Details
Human Interferon-induced protein with tetratricopeptide repeats 1 ELISA Kit
MBS9427374-02 5x 96 Tests

Human Interferon-induced protein with tetratricopeptide repeats 1 ELISA Kit

Sign In for Pricing
View Details
Canine β2-microglobulin (B2M) ELISA Kit-Sandwich
EK3F381-01 48 Test

Canine β2-microglobulin (B2M) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine β2-microglobulin (B2M) ELISA Kit-Sandwich
EK3F381-02 96 Tests

Canine β2-microglobulin (B2M) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Paeonilactone B
YDA75178-01 5 mg

Paeonilactone B

Sign In for Pricing
View Details