Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Tat (tat)

Product Specifications

Product Name Alternative

Transactivating regulatory protein

Abbreviation

Recombinant Human immunodeficiency virus type 1 group M subtype C tat protein

Gene Name

Tat

UniProt

O12161

Expression Region

1-101aa

Organism

Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) (HIV-1)

Target Sequence

MEPVDPNLEPWNHPGSQPKTACNNCYCKRCSYHCLVCFQTKGLGISYGRKKRRQRRSAPPSSEDHQNPIPKQPLPQTRGDQTGSEESKKKVESKTETDPFD

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Transcriptional activator that increases RNA Pol II processivity, thereby increasing the level of full-length viral transcripts. Recognizes a hairpin structure at the 5'-LTR of the nascent viral mRNAs referred to as the transactivation responsive RNA element (TAR) and recruits the cyclin T1-CDK9 complex (P-TEFb complex) that will in turn hyperphosphorylate the RNA polymerase II to allow efficient elongation. The CDK9 component of P-TEFb and other Tat-activated kinases hyperphosphorylate the C-terminus of RNA Pol II that becomes stabilized and much more processive. Other factors such as HTATSF1/Tat-SF1, SUPT5H/SPT5, and HTATIP2 are also important for Tat's function. Besides its effect on RNA Pol II processivity, Tat induces chromatin remodeling of proviral genes by recruiting the histone acetyltransferases (HATs) CREBBP, EP300 and PCAF to the chromatin. This also contributes to the increase in proviral transcription rate, especially when the provirus integrates in transcriptionally silent region of the host genome. To ensure maximal activation of the LTR, Tat mediates nuclear translocation of NF-kappa-B by interacting with host RELA. Through its interaction with host TBP, Tat may also modulate transcription initiation. Tat can reactivate a latently infected cell by penetrating in it and transactivating its LTR promoter. In the cytoplasm, Tat is thought to act as a translational activator of HIV-1 mRNAs

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF405S conjugate, 0.1mg/mL
BNC041118-500 1x 500 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8b, Mouse (H35-17.2), CF568 conjugate, 0.1mg/mL
BNC682003-500 1x 500 µL

CD8b, Mouse (H35-17.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF488A conjugate, 0.1mg/mL
BNC882041-500 1x 500 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details