Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse VIP peptides (Vip)

Product Specifications

Abbreviation

Recombinant Mouse Vip protein

Gene Name

Vip

UniProt

P32648

Expression Region

80-155aa

Organism

Mus musculus (Mouse)

Target Sequence

RHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPIKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) . Abundantly expressed throughout the CNS and peripheral nervous systems where they primarily exert neuroprotective and immune modulatory roles. Also causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASA1 Rabbit pAb
E45R22923N 50 ul

RASA1 Rabbit pAb

Sign In for Pricing
View Details
FBP1 (16B16) Rabbit Monoclonal Antibody
AMRe10859-01 50 µL

FBP1 (16B16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FBP1 (16B16) Rabbit Monoclonal Antibody
AMRe10859-02 100 µL

FBP1 (16B16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FBP1 (16B16) Rabbit Monoclonal Antibody
AMRe10859-03 200 µL

FBP1 (16B16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Integrin beta 1 Antibody, mAb, Rabbit
A02533-100 100 µL

Integrin beta 1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Mouse A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit
GA-E0728MS-01 48 Tests

Mouse A Disintegrin And Metalloprotease 17 (ADAM17) ELISA Kit

Sign In for Pricing
View Details