Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6 complex locus protein G6c (LY6G6C)

Product Specifications

Abbreviation

Recombinant Human LY6G6C protein

Gene Name

LY6G6C

UniProt

O95867

Expression Region

19-99aa

Organism

Homo sapiens (Human)

Target Sequence

DIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVFSNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNS

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1792), CF568 conjugate, 0.1mg/mL
BNC683810-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1792), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Pyrrolidinecarbodithioic Acid Ammonium Salt
TRC-P997985-15G 15 g

1-Pyrrolidinecarbodithioic Acid Ammonium Salt

Sign In for Pricing
View Details
IRF1-AS1 Mouse Monoclonal Antibody [Clone ID: OTI4B11]
CF811508 100 µg

IRF1-AS1 Mouse Monoclonal Antibody [Clone ID: OTI4B11]

Sign In for Pricing
View Details
TMEFF2 Rabbit Polyclonal Antibody
TA371568 100 µL

TMEFF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PLAC1L (OOSP2) activation kit by CRISPRa
GA116550 1 Kit

Human PLAC1L (OOSP2) activation kit by CRISPRa

Sign In for Pricing
View Details
FGF13 Rabbit Polyclonal Antibody
TA368325 100 µL

FGF13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details