Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Co-chaperonin GroES (groES)

Product Specifications

Product Name Alternative

10 kDa antigen;10 kDa chaperonin; BCG-A heat shock protein; Chaperonin-10

Abbreviation

Recombinant Mycobacterium tuberculosis groES protein

Gene Name

GroES

UniProt

P9WPE5

Expression Region

2-100aa

Organism

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Target Sequence

AKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

Tag

C-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-100 1x 100 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL
BNC741859-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL
BNC882298-100 1x 100 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (SPN/839), CF568 conjugate, 0.1mg/mL
BNC680839-100 1x 100 µL

CD43 (SPN/839), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details