Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Islet amyloid polypeptide (IAPP)

Product Specifications

Product Name Alternative

Amylin; Diabetes-associated peptide; Insulinoma amyloid peptide

Abbreviation

Recombinant Human IAPP protein

Gene Name

IAPP

UniProt

P10997

Expression Region

1-89aa

Organism

Homo sapiens (Human)

Target Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Amylin/IAPP is a glucoregulatory peptide hormone that plays an important role in the regulation of energy homeostasis. Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism. IAPP function is mediated by the CALCR-RAMPs (AMYRs) receptor complexes. Amylin can also bind CALCR receptor in the absence of RAMPs, although it is more selective for AMYRs

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KU-0058948
TRC-K660400-2.5MG 2.5 mg

KU-0058948

Sign In for Pricing
View Details
DSN1 (NM_001145318) Human Over-expression Lysate
LY428821 100 µg

DSN1 (NM_001145318) Human Over-expression Lysate

Sign In for Pricing
View Details
RAD54 (RAD54L) (C-term) Rabbit Polyclonal Antibody
AP53565PU-N 400 µL

RAD54 (RAD54L) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1700024G13Rik Mouse Gene Knockout Kit (CRISPR)
KN500117 1 Kit

1700024G13Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
mCherry Rabbit Polyclonal Antibody
HA500049 100 µL

mCherry Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HECTD2 Human qPCR Primer Pair (NM_182765)
HP227400 200 Reactions

HECTD2 Human qPCR Primer Pair (NM_182765)

Sign In for Pricing
View Details