Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Lutropin subunit beta (LHB)

Product Specifications

Product Name Alternative

Luteinizing hormone subunit beta

Abbreviation

Recombinant Cat LHB protein

Gene Name

LHB

UniProt

O77805

Expression Region

23-143aa

Organism

Felis catus (Cat)

Target Sequence

SREPLRPLCRPINATLAAENEACPVCVTFTTTICAGYCPSMMRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPVVSFPVALSCRCGPCRLSSSDCGGPRAQPLACDRPPLPGLLFL

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915969-01 48 Well

Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915969-02 96 Well

Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915969-03 5x 96 Well

Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915969-04 10x 96 Well

Sheep Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
RHOC CytoSection
TS417556P5 25 Slides

RHOC CytoSection

Sign In for Pricing
View Details
CrkRS Antibody / CDK12 / Cyclin-dependent kinase 12
F55075-0.08ML 0.08 mL

CrkRS Antibody / CDK12 / Cyclin-dependent kinase 12

Sign In for Pricing
View Details