Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria gonorrhoeae Ribonuclease HII (rnhB)

Product Specifications

Abbreviation

Recombinant Neisseria gonorrhoeae rnhB protein

Gene Name

RnhB

UniProt

Q5F5X9

Expression Region

1-194aa

Organism

Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)

Target Sequence

MHILTAGVDEAGRGPLVGSVFAAAVILPETFDLPGLTDSKKLSEKKRDALAEMIKEQAVAWHVAASTPEEIASLNILHATMLAMKRAVYGLAARPEKIFIDGNRIPEHLGIPAEAVVKGDSKIIEISAASVLAKTARDAEMYALAQRRPQYGFDKHKGYGTKQHLEALKQYGVLPEHRRDFAPVRNLLAQQALF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Endonuclease that specifically degrades the RNA of RNA-DNA hybrids

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase, Liver/Bone/Kidney (ALPL) BioAssayTM ELISA Kit (Rat)
023244 96 Tests

Alkaline Phosphatase, Liver/Bone/Kidney (ALPL) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
RSPH6A (NM_030785) Human Tagged Lenti ORF Clone
RC215886L4 10 µg

RSPH6A (NM_030785) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MAGEA1 (Melanoma-associated Antigen 1, MAGE-1 Antigen, Antigen MZ2-E, Cancer/Testis Antigen 1.1, CT1.1, MAGE1, MGC9326) (MaxLight 650)
MBS6223065-01 0.1 mL

MAGEA1 (Melanoma-associated Antigen 1, MAGE-1 Antigen, Antigen MZ2-E, Cancer/Testis Antigen 1.1, CT1.1, MAGE1, MGC9326) (MaxLight 650)

Sign In for Pricing
View Details
MAGEA1 (Melanoma-associated Antigen 1, MAGE-1 Antigen, Antigen MZ2-E, Cancer/Testis Antigen 1.1, CT1.1, MAGE1, MGC9326) (MaxLight 650)
MBS6223065-02 5x 0.1 mL

MAGEA1 (Melanoma-associated Antigen 1, MAGE-1 Antigen, Antigen MZ2-E, Cancer/Testis Antigen 1.1, CT1.1, MAGE1, MGC9326) (MaxLight 650)

Sign In for Pricing
View Details
Mastermind-Like protein 3 (MAML3) Human ELISA Kit
E8639 96 Tests

Mastermind-Like protein 3 (MAML3) Human ELISA Kit

Sign In for Pricing
View Details
Granzyme M (GZMM) Magnetic Fluorescence Assay Kit
MBS2155478-01 96 Tests

Granzyme M (GZMM) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details