Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly-6/neurotoxin-like protein 1 (LYNX1)

Product Specifications

Product Name Alternative

Endogenous prototoxin LYNX1; Testicular tissue protein Li 112

Abbreviation

Recombinant Human LYNX1 protein

Gene Name

LYNX1

UniProt

P0DP58

Expression Region

21-91aa

Organism

Homo sapiens (Human)

Target Sequence

LDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTYYTPTRMKVSKSCVPRCFETVYDGYSKHASTTSCCQYDLC

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Acts in different tissues through interaction to nicotinic acetylcholine receptors (nAChRs) . The proposed role as modulator of nAChR activity seems to be dependent on the nAChR subtype and stoichiometry, and to involve an effect on nAChR trafficking and its cell surface expression, and on single channel properties of the nAChR inserted in the plasma membrane. Modulates functional properties of nicotinic acetylcholine receptors (nAChRs) to prevent excessive excitation, and hence neurodegeneration. Enhances desensitization by increasing both the rate and extent of desensitization of alpha-4:beta-2-containing nAChRs and slowing recovery from desensitization. Promotes large amplitude ACh-evoked currents through alpha-4:beta-2 nAChRs. Is involved in regulation of the nAChR pentameric assembly in the endoplasmic reticulum. Shifts stoichiometry from high sensitivity alpha-4 (2) :beta-2 (3) to low sensitivity alpha-4 (3) :beta-2 (2) nAChR. In vitro modulates alpha-3:beta-4-containing nAChRs. Reduces cell surface expression of (alpha-3:beta-4) (2) :beta-4 and (alpha-3:beta-4) (2) :alpha-5 nAChRs suggesting an interaction with nAChR alpha-3 (-) : (+) beta-4 subunit interfaces and an allosteric mode. Corresponding single channel effects characterized by decreased unitary conductance, altered burst proportions and enhanced desensitization/inactivation seem to depend on nAChR alpha:alpha subunit interfaces and are greater in (alpha-3:beta-2) (2) :alpha-3 when compared to (alpha-3:beta-2) (2) :alpha-5 nAChRs. Prevents plasticity in the primary visual cortex late in life

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)
MBS1202551-01 0.02 mg (E-Coli)

Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)

Ask
View Details
Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)
MBS1202551-02 0.1 mg (E-Coli)

Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)

Ask
View Details
Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)
MBS1202551-03 0.02 mg (Yeast)

Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)

Ask
View Details
Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)
MBS1202551-04 0.1 mg (Yeast)

Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)

Ask
View Details
Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)
MBS1202551-05 0.02 mg (Baculovirus)

Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)

Ask
View Details
Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)
MBS1202551-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella typhimurium Cell division inhibitor SulA (sulA)

Ask
View Details