Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Interleukin-6 (IL6)

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey IL6 protein

Gene Name

IL6

UniProt

P79341

Expression Region

28-212aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

APVLPGEDSKDVAAPHSQPLTSSERIDKHIRYILDGISALRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway. The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163b Polyclonal Antibody
MBS8526387-01 0.1 mg

CD163b Polyclonal Antibody

Sign In for Pricing
View Details
CD163b Polyclonal Antibody
MBS8526387-02 0.1 mL (AF635)

CD163b Polyclonal Antibody

Sign In for Pricing
View Details
CD163b Polyclonal Antibody
MBS8526387-03 0.1 mL (AF610)

CD163b Polyclonal Antibody

Sign In for Pricing
View Details
CD163b Polyclonal Antibody
MBS8526387-04 0.1 mL (AF405S)

CD163b Polyclonal Antibody

Sign In for Pricing
View Details
CD163b Polyclonal Antibody
MBS8526387-05 0.1 mL (AF405L)

CD163b Polyclonal Antibody

Sign In for Pricing
View Details
CD163b Polyclonal Antibody
MBS8526387-06 0.1 mL (AF546)

CD163b Polyclonal Antibody

Sign In for Pricing
View Details