Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c (CYCS)

Product Specifications

Abbreviation

Recombinant Human CYCS protein

Gene Name

CYCS

UniProt

P99999

Expression Region

2-105aa

Organism

Homo sapiens (Human)

Target Sequence

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pitofenone Hydrochloride
TRC-P536500-100MG 100 mg

Pitofenone Hydrochloride

Sign In for Pricing
View Details
Recombinant Human NUDT3 Protein, N-His
HF767012-01 50 µg

Recombinant Human NUDT3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NUDT3 Protein, N-His
HF767012-02 100 µg

Recombinant Human NUDT3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NUDT3 Protein, N-His
HF767012-03 1 mg

Recombinant Human NUDT3 Protein, N-His

Sign In for Pricing
View Details
Cimex lectularius LOC106663315 Rabbit Polyclonal Antibody (Carrier-free)
orb3088820 200 µL

Cimex lectularius LOC106663315 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Baat sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7570708 1.0 µg DNA

Baat sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details